SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_30020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_30020
Domain Number 1 Region: 49-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.93e-37
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 344-402
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_30020
Sequence length 404
Comment (Pichia stipitis)
Sequence
MSEETCYGQLSSMMSKQLKVVDSRIKSSTKELDWNYLKRTPQFLKQRIKFGNGSYTSDEE
FNYLEKQFKETEKTLQSVEKYVKMYSKSTLTLLDRSTAVGKGYSLLYDPYEDLAKKTGEQ
SNSQVFEDQYRKWQNVNNYIETINMCKSEIENETKTLAAMVESKIQEIYSNINNIHKKIR
VRSYALVDYDKVYNSHDNLLLKQKSGELTVKQSQQLFSSERKLEENKVKFDEINDLLKKE
LPYFLKLVELILTPLQEYVYYVQLMNYFQFSSRCKSYANFINLDVRIISSPNFADELMTQ
NSIDSLGAYDSINQLTLINFRDRYLSDITLALEPENRNPILKETNSYYYMAKFNFEGQQE
GDLSFKHGDIITVLTRNGNWWKGELDGVVGIFPRNYVEEYSPRD
Download sequence
Identical sequences A3LPP0
4924.PICST_30020 XP_001383104.2.38308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]