SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_80880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_80880
Domain Number 1 Region: 61-198
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-49
Family Ran-binding domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_80880
Sequence length 199
Comment (Pichia stipitis)
Sequence
MSAEDTKPVVAEEAAAPKPPTANVFSMFGGSKKEKKDEEEPETKEEKKGDDEEAAAEEEV
DVHFEPLVQLEKVDVKTNEEDEEVLYKVRAKLFRFHGDTKEWKERGTGDVKFLKHKESGR
VRILMRRDKTLKICANHLISGDYELKPNIGSDRSWVYTVTADISEGEPEAQTLAIRFGNK
ENADKFKEHFDEARDAAKK
Download sequence
Identical sequences A3GH31
XP_001386770.1.38308 jgi|Picst3|80880|estExt_gwp_genewisePlus_worm.C_chr_1.20028 4924.PICST_80880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]