SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DFV9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DFV9
Domain Number 1 Region: 38-100,139-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-31
Family BAR domain 0.037
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-23
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DFV9
Sequence length 387
Comment (Pichia guilliermondii)
Sequence
MDLGSISSLIESLRKAESPVKSSICAIGTKAALQFKKKWVEDAIIDEEYDDLKLRINCME
KNLKELVRHIDAYCINFDELLQTSRKIGESAKAVFDPYHSLSKSTLTKLGEYQSIERSSL
FSSQTKCLQFGNGYASWARSSDLADISERIHKRNQKELDFVREVVTTKASEAQKYIDSIG
KTMKNRQSILTQYSRTTFELNDLLKKKEANQLSLKQSQQLFSQERKAEMLLQDYEAVNFT
LKSTMPKLLQLNDELTTTLQQMVYYLQLTIFYQVDLQLTSLEEVFKVTNGDSDPQVGLST
LTREIDGFKIVNRYSNAKSSASPDKKDQSTEVCIALYDFEAQQDGDLTIKKGDRVKLLDK
GKGWWKGELDGKVGLFPHNYVKLVASS
Download sequence
Identical sequences A5DFV9
PGUT_02160 4929.A5DFV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]