SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DGP2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DGP2
Domain Number 1 Region: 139-276
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.19e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000726
Further Details:      
 
Domain Number 2 Region: 289-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000082
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DGP2
Sequence length 482
Comment (Pichia guilliermondii)
Sequence
MENPASSRPTKWSGTPLRHKTIDGQKLDTIISGHLTSEQLDAYQQYFRIEEISDLLRTSN
KRRVGVLSLLPSGKPQENPNLKRDPSPPPKYDNYGNRVNTRDSLMGLSLENERHYLVEKA
ASTIKYYMSPLDYHKPAKIYEKLYIPLKDFPDINFVGLLLGPRGNTLRQIQEDSGAKLAI
RGKGSVKDGKSSGNVITESEESGALMSPKSFANPFVDNNSEDLHVVITADSSRKIEKAIM
FANEIINKAISSPMGQNDLKRGQLRELAILNGTLRESRPFIPEEERQAPPVMDISSIVCK
ICGKVGHFARDCKLRNRNESAPERSYQPPEPQYAPEEEAVPASYSYEPRHKENGRRRDDD
ASLPPWKRQKPSIPSLPVSPWQSQPPIPTPLARSTPPMQTQTLQNTKPKPPPGLHMGERP
PPPANTLKPPPPATTSKPPPPTTILKPPPPSSAPKPPPPTSKPVPPAKPAPPPPTKKPDP
PS
Download sequence
Identical sequences A5DGP2
PGUT_02443 4929.A5DGP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]