SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YAL041W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YAL041W
Domain Number 1 Region: 268-475
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 751-853
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.52e-19
Family PB1 domain 0.0000134
Further Details:      
 
Domain Number 3 Region: 473-521,603-668
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000916
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  4932.YAL041W
Domain Number - Region: 146-242
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.025
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4932.YAL041W
Sequence length 854
Comment (Saccharomyces cerevisiae)
Sequence
MAIQTRFASGTSLSDLKPKPSATSISIPMQNVMNKPVTEQDSLFHICANIRKRLEVLPQL
KPFLQLAYQSSEVLSERQSLLLSQKQHQELLKSNGANRDSSDLAPTLRSSSISTATSLMS
MEGISYTNSNPSATPNMEDTLLTFSMGILPITMDCDPVTQLSQLFQQGAPLCILFNSVKP
QFKLPVIASDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFANSTSQLVKVLEVVET
LMNSSPTIFPSKSKTQQIMNAENQHRHQPQQSSKKHNEYVKIIKEFVATERKYVHDLEIL
DKYRQQLLDSNLITSEELYMLFPNLGDAIDFQRRFLISLEINALVEPSKQRIGALFMHSK
HFFKLYEPWSIGQNAAIEFLSSTLHKMRVDESQRFIINNKLELQSFLYKPVQRLCRYPLL
VKELLAESSDDNNTKELEAALDISKNIARSINENQRRTENHQVVKKLYGRVVNWKGYRIS
KFGELLYFDKVFISTTNSSSEPEREFEVYLFEKIIILFSEVVTKKSASSLILKKKSSTSA
SISASNITDNNGSPHHSYHKRHSNSSSSNNIHLSSSSAAAIIHSSTNSSDNNSNNSSSSS
LFKLSANEPKLDLRGRIMIMNLNQIIPQNNRSLNITWESIKEQGNFLLKFKNEETRDNWS
SCLQQLIHDLKNEQFKARHHSSTSTTSSTAKSSSMMSPTTTMNTPNHHNSRQTHDSMASF
SSSHMKRVSDVLPKRRTTSSSFESEIKSISENFKNSIPESSILFRISYNNNSNNTSSSEI
FTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEM
LAENNEKFLNIRLY
Download sequence
Identical sequences A0A0L8VVQ8 B3LUX7 C7GPJ6 C8Z3E8 E7K934 N1P7H4 P11433
NP_009359.1.97178 SCRT_05678 YAL041W GO.34661 YAL041W YAL041W 4932.YAL041W YAL041W YAL041W YAL041W YAL041W YAL041W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]