SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YBR013C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4932.YBR013C
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily TPR-like 0.0417
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YBR013C
Sequence length 129
Comment (Saccharomyces cerevisiae)
Sequence
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY
Download sequence
Identical sequences P38215
YBR013C NP_009569.1.97178 YBR013C 4932.YBR013C YBR013C YTYst418 YBR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]