SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YDR224C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YDR224C
Domain Number 1 Region: 31-127
Classification Level Classification E-value
Superfamily Histone-fold 6.36e-79
Family Nucleosome core histones 0.00000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YDR224C
Sequence length 131
Comment (Saccharomyces cerevisiae)
Sequence
MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
Download sequence
Identical sequences A0A0L8VTA7 A0A250W9E2 A6ZYH8 B3LG63 C7GVC8 E7KB07 E7LSX7 E7NFW7 E7Q2B4 E7QD15 G2WAW9 H0GSY3 J5RUU4 N1P503 P02293
YDR224C YDR224C YDR224C 4932.YDR224C YDR224C YDR224C 4kud_D 4kud_H 6gej_G 6gej_H 6gen_G 6gen_H ORFP:4582 YDR224C YDR224C YDR224C SCRT_00300 ORFP:4084 YDR224C NP_010510.3.97178 YDR224C tr|A6ZYH8|A6ZYH8_YEAS7 YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]