SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YKL026C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YKL026C
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-53
Family Glutathione peroxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4932.YKL026C
Sequence length 167
Comment (Saccharomyces cerevisiae)
Sequence
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV
AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI
KMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI
Download sequence
Identical sequences A0A250WJJ4 A6ZZT7 C8ZCE1 E7QHB8 G2WI03 H0GJA3 N1P0C0 P36014
YKL026C YKL026C NP_012899.3.97178 YKL026C YKL026C YKL026C YKL026C 4932.YKL026C tr|A6ZZT7|A6ZZT7_YEAS7 YKL026C YKL026C YKL026C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]