SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YNL313C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YNL313C
Domain Number 1 Region: 634-739,792-827
Classification Level Classification E-value
Superfamily TPR-like 1.39e-17
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  4932.YNL313C
Domain Number - Region: 516-603
Classification Level Classification E-value
Superfamily TPR-like 0.00569
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YNL313C
Sequence length 904
Comment (Saccharomyces cerevisiae)
Sequence
METLLHAKLLLSAEVESLKSGSFDQTYVKKAEHIISGESYQLVQQFVDKFKGKISISGEI
STSSVIAALNDFLNVEVFKMGQENEMLFLAIALLQTFIQNNYTGPAARLKAISGLFGKTG
IEIGAVNTALSRSLAIMGQPAYEFMDDPLYLVLSLLLLERITGQKSLFDVTPDQEIPLPI
ISAESTPGLLAVAYWWWARALLTQLSLIPEPSGFQASVASAIYQSADLAYAITKELPESI
HEDFKRELCAMYYLENVKCSLAINTEHLCLPSLTRAKKITNFEFVMTGARATRTKYQQKA
HAGLIILAKSFTFQNFALRTTSATPETFALESDLLLEKPHFESIADEPLDEQIYSKRQKV
DLNEGYEEDKLLPLALRQENIPKLLLDLNPNDQPTLSDYDNIQLLLRLYTIKNTTPAKDP
LVEEELTALLSRILYQNGDKNWSIFARSLWERSIIETTKAKTIERGLLQMQSLVEELDLK
IKSKLVPSSSEINVASRLSYIHQLPFIPRWQLDATLAEKYMSLGILKSAVEIYERLGMAC
ETALCYAAVGDEKKAEEILLQRINENDSDARAYSILGDIKQDPSLWEKSWEIGKYVNAKN
SLAKYYFNPPPKSGAQPNYSATLKHLNDSLRQYPLSFETWYFYGCVGLQCGKMQIAAEAF
TRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLVAVKLN
EWEDVLTACKQLVSIRRDKSGEGSIDLPIIEKLVELLVTSEYPEEPQQLSYFQKSCTEFI
CNTLPQVITTSARCWRLVARVELWRKRPWAALECHEKAYRAISHNPDLEVEEKVWNDTVD
ACEDLVAAYESLGEMEGKYGPGSLVCKDWKYKCRSTIKALMSKGKGRWDDSPGWDRLVEA
RSQI
Download sequence
Identical sequences N1NXU2 P42842
4932.YNL313C YNL313C YNL313C YNL313C YNL313C NP_014086.1.97178 YR283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]