SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YOR004W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YOR004W
Domain Number 1 Region: 25-151
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000000000549
Family PIN domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4932.YOR004W
Sequence length 254
Comment (Saccharomyces cerevisiae)
Sequence
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM
ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA
SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ
ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEKKKRRRRKHKS
NTNVPVSNGTTAAQ
Download sequence
Identical sequences A6ZNK9 B3LJ59 B5VRQ6 C7GJU9 C8ZHW7 N1NWE9 Q12339
YOR004w___KOG3164 YOR004W YOR004W YOR004W YOR004W YOR004W SCRT_01406 YOR004W YOR004W YOR004W YOR004W YOR004W YOR004W YOR004W YOR004W 4932.YOR004W YOR004W YOR004W YOR004W tr|A6ZNK9|A6ZNK9_YEAS7 YOR004W YOR004W YOR004W NP_014646.1.97178 YOR004W YOR004W YOR004W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]