SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YOR080W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YOR080W
Domain Number 1 Region: 33-163
Classification Level Classification E-value
Superfamily TPR-like 5.46e-17
Family Tetratricopeptide repeat (TPR) 0.0097
Further Details:      
 
Domain Number 2 Region: 562-711
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000392
Family 28-residue LRR 0.062
Further Details:      
 
Domain Number 3 Region: 217-288
Classification Level Classification E-value
Superfamily F-box domain 0.00000000051
Family F-box domain 0.0052
Further Details:      
 
Domain Number 4 Region: 312-398,459-607
Classification Level Classification E-value
Superfamily RNI-like 0.000000022
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YOR080W
Sequence length 746
Comment (Saccharomyces cerevisiae)
Sequence
MSYKFITKNKKYTPMSSPGNSGVAIDSTVLKAIELGTRLFKSGEYLQAKRIFTNALRVCD
SYSQEQIMRIRNAYQLDTARPDNKRLYHPRYIKILDNICACYEKLNDLKSCLDVSQRLLK
LEPGNIKCYIRCTRTLIKLKDWKRAYKTCSRGLQLCNNDSNHLRQQKQFIKNNMVQKQDG
KRSYIDPLEETKIAKKKKNNNVLESLPKKKIKGSTKKTDLVGNLPIEILPIIFQRFTTKE
LVTLSLVCNKWRDKILYHLDCFQEFNLAPINFKNFVKFMDFLQQNFTRTYRKYILSQVKV
SSRITSEELRITQLLFSKMPKCINIERLILSMPTLTTTQIFKLMVRGGTDFFTRLLELSL
MITYRPDKQHELEILQTCPLLKKIELIFVNSLVPIFDGNNSVGRDGSFNVMARHTNMQIS
TADNDEQGIVEEKVIYSELEKITLICDKKKIKNFPLCRALLRGQFPLLQKLTITGVTFPM
NNQDIMNFQWLLNFPDLKELWIEDNDNCELSKFLQLLKFSNVWKNLEKLTFRENKLYPIV
NLDEDQPVTNDDEVPSMLFYKENLQNLEKLDLMGTSISGSALTRLCEQEYLDGRKLRSLN
IGNCPNIQFPNNHAHTARMILDVNAVLKRLSKLEEINLSHLSSLNDSTMKSFIINVPFLE
NLKRLDISHNFEITGISIYEFLKKFQMDHDNEAGGQPLAYLNIDGCSQVSHITVNMIRAQ
NLVTQVDCVYERDVWRKFGINSYSYS
Download sequence
Identical sequences 4932.YOR080W YOR080W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]