SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6C7G9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4952.Q6C7G9
Domain Number 1 Region: 85-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000319
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Weak hits

Sequence:  4952.Q6C7G9
Domain Number - Region: 9-71
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000665
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 
Domain Number - Region: 309-375
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6C7G9
Sequence length 402
Comment (Yarrowia lipolytica)
Sequence
MVKRSHNQLNEDEAHMRFIVASEQAEKLLIKKQQSLRELSKSLCIKIKFSPFINTHTDRV
MSITGTPENIGSTIGSLVRTWTGNNDDSSAQFTIQMIIPEPMVAKIVGFKGYGLRKLHRK
SGAAIEAIKDGLPDSTDRLFTATGVADSLHRAVYFTSLIFQEYTGLLKRFEQESSPYEPR
DNINPLRRRITGTYIPPDSPAHFVSRKKKTAETKHKHTMEVIAGSSPNQPMVVSGSREAV
SSACTKVEDLPQESIETLPCSPPPETEYKLASKRFESPPPSPLLLDTPVKSQKEECILVC
PPSPPLSIDDNVVTKRLMVTCPMVGTMLSLSEELLNLMRQNSGAAIRVKEIVSHEQIQLI
ITGTKSQVSRVMEDLTLTTRNSYLFTKAIEQSECEYLEEQDA
Download sequence
Identical sequences A0A1D8NGN8 Q6C7G9
gnl|GLV|YALI0E00924g 4952.Q6C7G9 XP_503393.1.88470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]