SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BWU3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BWU3
Domain Number 1 Region: 56-119,160-306
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-34
Family BAR domain 0.013
Further Details:      
 
Domain Number 2 Region: 354-425
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BWU3
Sequence length 426
Comment (Debaryomyces hansenii)
Sequence
MEQTNMKVSSQVLNMNQISSLVSKQLKVADKKFKTSTKEHFDWSNIKRTPQLLRRKANLE
SYTVDEGFDELESNLLYIEKKLNCLIKYTSGYCSGILKVLTHSKNIGLFLQQLFDPYNTL
PDSIKTKLEANRNFDSQNESIFSSASRQCIFREEYEIWSNCASYVECTKTIEPSIKNEIE
ILGAMVEVRVSEMLSLISFIKKHIRNRNYALMDYDKTYNAHESLALRHKTDELSIKQSQQ
MHNLERKLEGNKVIYTDLNGLLKKELPFFFKLVDSILQPIQLRTYYVQLLVSYQININLL
SIQDIFHIDLEELKRDTNGIIEQFNSKNKVASDLLNSLSIINFRENFFGELTGSPPLFKP
ERTLINNYDSDYKYCQAIFSFRGQQEGDLSFKAGAIIKIFDKSGGWWRGSIDDEVGLFPG
NYVKML
Download sequence
Identical sequences Q6BWU3
4959.Q6BWU3 XP_457326.2.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]