SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498213.CLD_0372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498213.CLD_0372
Domain Number 1 Region: 441-539
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000196
Family Collagen-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 562-663
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000458
Family Collagen-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  498213.CLD_0372
Domain Number - Region: 351-431
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00112
Family Collagen-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498213.CLD_0372
Sequence length 689
Comment (Clostridium botulinum B1 Okra)
Sequence
MVKSKEKNKIFFTLLAITLIFIVNSNKVKANDEINFRRLDGKERYETSASICSGGWDTSE
YAVLASGEGFADALSAAPLAKKYDAPIILTGKNKLNDNAKDQLKKLDTKEVIIVGGPGSI
SEDIVTELKDLGIKVNRIYGEDRYKTSLKIAKEIGVKNGIVVTNGLGFADALGMAPIAAS
KQMPILLTPSDKLTSDTMEFLKKSSYNKSYVLGGTATVSDYIKNSLKNPTRLSGADRYKT
NIAILNHFKGDLNLDEVYIASGDGYADALSGSVLASKNKSPIILINDNLNKSTKDFVSTN
KYNFKNVTIFGGEAVVKEPTISSLFGAFRSGETRSDTKEVVAEKWDRSYLKDYHIDLPEG
GKLDIEYDINNFTRFDLIVLDIKNNEIIKKSYNYLKNNKSIHDNYNDIRLPKGKYIVRVH
AFNMDGTYTIKAKYTQEGEGFEKESNNDIKTANVIEPNKSIIGSIHSYNDVDYYKFTLNE
KGSLKINLKHNQYGRYGFKVSLVDENNKSIAEFISGGEDINSYSNKLRLSKGTYFVRIEC
EKWNDEPLQYELNLVYDIEGENYESEPNDYIQDANYIKCDKEYIGNIQSISDRDYYKINL
NSDSKITINFKHDEGYGKWTIYLCDKDNKPIKRFKSYGYEISKDFDPVELEAGEYYVSVE
GIDSIDYTINVKREAPDKSNNENKKVKRR
Download sequence
Identical sequences B1IDD6
WP_003399381.1.21789 WP_003399381.1.53136 498213.CLD_0372 gi|170757215|ref|YP_001780032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]