SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_3567 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_3567
Domain Number 1 Region: 562-663
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000126
Family Collagen-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 441-554
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000128
Family Collagen-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  498214.CLK_3567
Domain Number - Region: 347-431
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00103
Family Collagen-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_3567
Sequence length 689
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MVKSKEKNKIFFTLLAITLIFIVNSNKVKANDEINFKRLYGKERYETSASICSGGWDTSE
YAVLASGEGFADALSAAPLAKKYDAPIILTGKNKLNDNAKDQLKKLDTKEVIIVGGPGSI
SEDIVTELKNLGIKVNRIYGEDRYKTSLKIAKEIGVKNGVVVTNGLGFADALAMAPIAAS
KQMPILLTPSDKLTSDTMEFLKKNSYNKSYILGGTATVSDYIKNSLKNPTRLSGADRYQT
NIAILNHFKGDMNLDEVYISSGDGYADALSGSVLASKNKSPIILINDNLNKSTKDFVSTN
KSNFKNVTIFGGEAVVKEPTISSLFGAFRSGETRSDTKEVAAERWDRSYLKDYHIDLPDS
GKLDIEYDINNFTRFDLIVLDIKNNEIIKKSYNYLKNNKSIHDNYNDIRLPKGKYIVRVH
AFNMDGTYTIKAKYTQEGEGFEKESNNDIKTANVIEPNKSIIGSIHSYNDVDYYKFTLNE
KGSLKINLKHNQYGRYGFKVSLLDENNKSISQFISGGEDINSYSNKLRLSKGTYSVRIEC
ERWNDEPLQYELNLDYDIEGENYESEPNDYIQDANYIKCDKEYTGNIQSRDDRDYYKINL
NSDSKITINFKHDEGYGKWTIYLCDKDNKPIKRFKSYGYEISKDFDPVELEAGEYYVSVE
GIDSIDYTINVKRESPDKSNNENKKVKRR
Download sequence
Identical sequences B1KUI1
gi|170761154|ref|YP_001785716.1| 498214.CLK_3567 WP_012344409.1.9908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]