SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00006293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00006293
Domain Number 1 Region: 119-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00006293
Sequence length 354
Comment (Aspergillus clavatus)
Sequence
MPSTYKRDKPWDTEDIDKWKIDPFKPDDNVAGSFAEESSFATLFPKYREQYLKEAWPVVT
RALEKHGIACTLDLVEGSMTVKTTRKTYDPAAILKGRDLIKLLSRSVPVQQALKILDDEV
ACDIIKIRSQVRNKERFVKRRQRLLGPSGSTLKALELLTSTYILVQGNTVAAMGPYKGLK
EVRRVINDCMANIHPIYHIKELMIKRELAKDPTLANESWDRFLPNFKKRTLSKRRTPFKV
TDKSKKAYTPFPPAPEKSKVDLQIESGEYFLSKEAKERAQKEEVMERQRVKREEKMQERA
KAFVPPEELQAEKERKEKKEKKKRKREAEAEADVEGSEKKEKRKKKKSKSKDDA
Download sequence
Identical sequences A1C6I1
5057.CADACLAP00006293 ACLA_070340 XP_001275428.1.35617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]