SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 509169.xccb100_3498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  509169.xccb100_3498
Domain Number 1 Region: 119-207,236-468
Classification Level Classification E-value
Superfamily Subtilisin-like 1.96e-72
Family Subtilases 0.00000287
Further Details:      
 
Domain Number 2 Region: 482-569
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000235
Family Collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 509169.xccb100_3498
Sequence length 580
Comment (Xanthomonas campestris B100)
Sequence
MSTASLRKRTGSLTILGASALTSLLLAMPAFAGEVYLDGLATAQTHQKFIVTYKDGSTAL
ASPSALTTSLRTAARAVPAKAGKALGLNSVRRLALGPELVRADRALDRAEAETLMRQLAA
DPNVQSVEVDQILHATLTPNDTRLSEQWAFGTTNAGLNIRPAWDKATGSGTVVAVIDTGI
TSHADLNANILAGYDFISDATTARDGNGRDSNAADEGDWYAANECGAGIPAASSSWHGTH
VAGTVAAVTNNTTGVAGTAYGAKVVPVRVLGKCGGSLSDIADAIVWASGGTVSGIPANAN
PAEVINMSLGGGGSCSTTMQNAINGAVSRGTTVVVAAGNDASNVSGSLPANCANVIAVAA
TTSVGAKASYSNFGTGIDVSAPGSSILSTLNSGTTTPGSASYASYNGTSMASPHVAGVVA
LVQSVAPTALTPAAVETLLKNTARALPGACSGGCGAGIVNADAAVTAAINGGSGGGGGGG
NTLTNGTPVTGLGAATGAELNYTITVPAGSGTLTVTTSGGSGDADLYVRAGSAPTDSAYT
CRPYRSGNAETCTITAPSGTYYVRLKAYSTFSGVTLRASY
Download sequence
Identical sequences B0RUC1
WP_012439137.1.10627 WP_012439137.1.22538 WP_012439137.1.4502 WP_012439137.1.82601 gi|188992893|ref|YP_001904903.1| 509169.xccb100_3498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]