SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 511995.CFPG_469 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  511995.CFPG_469
Domain Number 1 Region: 297-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000717
Further Details:      
 
Domain Number 2 Region: 13-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-40
Family Ribonuclease PH domain 1-like 0.0000835
Further Details:      
 
Domain Number 3 Region: 452-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 146-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-25
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 620-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.55e-18
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 6 Region: 559-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.35e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 511995.CFPG_469
Sequence length 719
Comment (Candidatus Azobacteroides pseudotrichonymphae genomovar CFP2)
Sequence
MINSIIKTIDLGDGRTITLETGKLAKQADGAIVLRMNNTMILATVCVAKDTNPCVDFLPL
QVEYKEKFSAFGRFPGGFTKREGRASDYEILTCRLIDRTLRPLFPRDYHSEVFVNIILFS
SDGEDIPDALAGLAASAALSVSTIPFNGPISEVRVARIDGKFKINPTFGELAKADMDIMV
GATADNIMMVEGEMNEVSEEEMLEAIKAAHEAIKPQCKAQIELARIVGTTIKNTYSHEVN
DEELRSDIKTKLYDKVYAVAKSGQCKNKRIEAFQTIIEEYKKQFKEKELSEEKIFLIKRY
YYEIEKEVMRRCILDENIRIDGRKTTEIRPIWSEVNPITGPHGSAIFTRGETQALATVTL
GTKLNEKIIDDVLINDKERFLLHYNFPPFATGEARAQRGIGRREIGHGNLAHRALKPIIP
NNYPYVIRVVSDILESNGSSSMATVCAGTLSLMDAGVQIKRPVSGIAMGLIFEKEGSKYA
ILSDILGDEDHLGDMDFKVAGTKKGITATQMDIKIDGLSYEVLERALSQAKQGREYILDK
MLETIPEPRTDLKPHTPKIEIIIIPKEFIGSVIGPGGKIIQRLQEETGTTITIEEIEKMG
RIEIFGDNKKSIDAALTRIKGIVSVPEVGEIYEGKIRSIMPYGAFIEFLPGKEGLLHISE
ISWKHLESIEEAGLNEGDFIKIKLVDIDSKTGKFKLSHKILLPHSEKYTAIRREQHEKI
Download sequence
Identical sequences B6YRB0
WP_012573493.1.38342 gi|212550826|ref|YP_002309143.1| 511995.CFPG_469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]