SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU05598.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU05598.1
Domain Number 1 Region: 24-280
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.16e-96
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000409
Further Details:      
 
Domain Number 2 Region: 370-540
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-62
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000329
Further Details:      
 
Domain Number 3 Region: 282-363
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000000049
Family Rhamnogalacturonase B, RhgB, middle domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU05598.1
Sequence length 540
Comment (Neurospora crassa)
Sequence
MGFLTLFHMAFLAVSLFVSGALAAFGYTTSGNNFVIDAGSANPLIFSVSKSSCDINSIRY
RGTELQYSKQGSHIGSGLGKATVSVSQINGSKSKFIKVTCVTSTLTQYMIVKEADSTIYM
ATYITAEPAIGELRFIARLLSDKLPYEYPYGEVSTTKGSSSTVEGSDVFVVNGQTRSKFY
SSTRFIDEDSHCVYGGSDLTHVCIITPQQESSSGGPFFRDIDSNNAGESTNLYNYMNSGH
VQTEDRRMGLHGPYLMTFSRSGIPKLKTVDISWFGELGVTGYVPDSQRGTVIGRATGIPS
GFEGVVHWYNAAAQYWVRTAPNGDFTSPKMKPGTYTMVLYQTEFKVATSTVTVSAGKTTT
ASIASTFNTSHTTLFKIGEYDGQPTGFRNADKFLRMHPSDSRMSSWGPLTYTVGSSSLND
FPMAVFKSVNNPVTIKFNLGSAPSQATTLRIATTLSFAGARPQVVVNGWSAPAPAAPAKI
DSRGVTRGAYRGYGEVYDVAVPAGKLISGTNTITISALSGSSGATFLSPNFIFDAVELFY
Download sequence
Identical sequences A0A0B0E813 P78710
5141.NCU05598.1 XP_960560.3.24337 NCU05598T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]