SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI74635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI74635
Domain Number 1 Region: 41-267
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.26e-64
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00021
Further Details:      
 
Domain Number 2 Region: 242-472
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.53e-53
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI74635
Sequence length 1118
Comment (Trichoderma reesei)
Sequence
MDCSRKRNLDDEEEGDFRVLSSLSRPISPPRKRIRQGQFHKSPWQLTRIRDLPEELNRDT
VRLRDILDDPLITECWQFNFLHDIPFVLSAFDDMVRNRVQLHVVHGFWKKDDESRIVLSD
QAAQFHNVHLHCAPMPEMFGTHHSKMMVIFRSDDTAQVVIHTANMIPKDWTNMTNAVWRS
PRLPRLGEQDTLFQQGQQLPVGSGTRFKVDLLEYLRQYELYRPTCKQLVDRLVNFDFSSI
RAAFIASVPGRHSFRDASRPAWGWAAVQRCLRCVPVERGQSQIVVQISSIATLGAKDDWL
QRTLFDSLATSLTPNTGRPGFKVVFPTVDEIRNSIDGYASGRSIHTKIQSPQQIRQLGYL
RPILHHWANDSAGGAKLPGEPSISGDSGRDRAAPHIKTYIRFNESNTIDWAMLTSANMSK
QAWGEALSSTTGNIRIASWEVGVLVWPGLLCEDGAMVSSPKSLVPSLALPFSILYLCTVW
TASTREANLGPAASGIPGPSGHDHPAFPSSFRSASPLAGQVLAQDIAECTDDDFDPADDQ
IDGEHSHHFMYRRPSGVAYGAARPAFNPNGLDEPILTPLERKQSRDAERSLLRDNHVLPP
KHNNKSQSIPARIYRKIFSTKVPVEEYEGESEDDSPLLSRDDDLDYGTRSRRQRPVPEGE
EDVDEQWEEAITTGRIRTTWQREAKTVLSYCGPLIVTFFLQYSINVAGIFAVGRIGTIEL
GAISLANMSQAISCLAPFQGLATSLDTLCAQAYGSGHKHLVGLQCQRMACFLLTLSVPVI
LLWLFGAEPILQRMVPDPESARLAALYLRVMIFAIPGVILFECGKRFTQSQGLFQATTYV
LLFAAPFNVFLTWLLVWKLEYGFIGAPIAVAITENILPVLLFCYVRFVNGRECWGGFSKR
ALSNWWVMIRLALPGMIMVEAEWLAFEILTLLASRFGSDYLAAQSVVSTIASISYQIPFP
MSIAASTRVANLIGAGLVDAARVTGKVTFVTHCILGLLNFALYSGLRYHLPLLFTDDETV
ISIVASILPVVAVMQVFDCLSAGAHGLLRGIGKQSIGGPVNLISYYAVSLPISLALAFGA
NWKLQGLWAGVSVGLFLYVEPSSSTRDATRFCGTLTYS
Download sequence
Identical sequences A0A024S0S1 G0RAQ2
51453.JGI74635 XP_006962086.1.9351 jgi|Trire2|74635|estExt_GeneWisePlus.C_20184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]