SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000010035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000010035
Domain Number 1 Region: 577-946
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-50
Family Ankyrin repeat 0.0000826
Further Details:      
 
Domain Number 2 Region: 227-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-35
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1123-1182
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00082
Further Details:      
 
Domain Number 4 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000863
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 5 Region: 924-1099
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000011
Family Ankyrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000010035
Sequence length 1188
Comment (Ciona savignyi)
Sequence
FFSDELSKTRQHLSLLREQYVKLQLEHAELQRSHSALKALQSNEVKATPPDHSLASGLLH
ITTKLFGNDLYSDIEIKLAHKSIPGHKFVLAARGAMCWDLNTLNTLSVLDLQNLDQQAGE
AIVRWLYTDTVNLTDTSDDFIIQMMKTSSKYNLHDVSRRCEQAIMSVVTVKNCIRFYELA
EDLKAASLKDYCSSLVSMHWHDLSPQEFSFMAAPMLYTMLKSKSQWPLHRAIRARREDVV
FLYLIEFDSQLPAKLNERNDDGEWPIQLALSTHQDSIARTLVSHRVDINGCDNNGQTHLH
RAVIEGDGYTGMFLLDYGANVNMSCRADGNTGLHLVSSVHFGPESKHDMDSITRLTANML
KKGGNPNLPNALGLTPLHLSIQHKNMPVFKLLLDYPETDMEIRTRDGHPSLWLALDSSND
TSVVYHDHSMAALLIKQGCNVDSPHPNTGSSLLQLCMINSNETGGLFLAKHRGNVNHINS
KGESPLHISCLHGLIQLTECLLAKGADPNIQCPTPLVCPGETPSGSDVVNETALHVAIRC
QHHEVVQLFLEHRANTQHSKQGLIATDFSIQDSNSNTVLALAVWSGFYKVAAQLLSSGAD
INYKNAVGRTLLHQAIEKKDISSSLFLLEHQADCHARSGDDETALEMGVKQGLAVVVDAL
CLRGADVDISDAAGDPLLWIALQNGMDDIASTLVHYRCNTTKWRGEHNLLHRAIADKNER
IACFLIRSGCETDTPAPPMEGVEGQTPMHMASQLDLQLTLEALLERNARINAQDSNMQTP
LHLAVVNNHLSITSTLLTHTSINLTLVDNMGRTPFASAMHRKNVECAKLILKRDPGAAEQ
MDKNGLNFLHSAIVARDLDSILFLISIGSDVNSLTCNTHQSSALHLAVGVGDVLIVRNLL
LAGAHTAVVDKHKQSALHVAAVRNPTIAGVLVENGADVGHVDLHGNNGDQVQWLCSIQQP
FDYSSMLLPCYSVGQNLCTLILTLTPTVFHVACKHGSLETLSTLTQALPNLAQVLVACNN
RGQTVLHVMAEDSSSKTSAMFDAVMRAMPDYPLAVQDNHGNTGIGTLLLAYMNGNGSLCR
SLVRTGSSLAITNNDGVNLFNHPVATKQLLFRLLDLLSQEPPWAEGNSCLECGVRFGVAT
RKHHCRHCGRILCSKCSSKIIPILKFDVSKPTRVCDLCYDVLTLGAIH
Download sequence
Identical sequences H2YXH4
ENSCSAVP00000010035 51511.ENSCSAVP00000010035 ENSCSAVP00000010035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]