SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000013166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000013166
Domain Number 1 Region: 22-288
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.33e-38
Family Proline iminopeptidase-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000013166
Sequence length 294
Comment (Ciona savignyi)
Sequence
MGEDTEKVAKTFSGRPFSEVNHFVNEDGLHIFTNIWKPEGDCKYLICLLHGFGGHCVRFN
ELASYLTKIGGLVFSHDHIGHGESEGYRTTVDDFNKLIRDTYQHVDIMKKQYSDLPVFLL
GQSMGGALAVLAAHERPDIFKGVILIGPMLLIDPGIQSSFKVSLVKIAAYLIPHFIVTSL
PESRGSRDEKEVVISQNDPLKSCDVKSQMALQLLRMGEKLEIVMPEFACPFITLHGGDDN
TCSVEGSKLINQVAKCKDKTIKIYDECRHDLVHELQADRIIFFNDIQAWVEERI
Download sequence
Identical sequences H2Z6F4
ENSCSAVP00000013166 51511.ENSCSAVP00000013166 ENSCSAVP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]