SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B0435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515621.CLJ_B0435
Domain Number 1 Region: 562-670
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000575
Family Collagen-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 441-539
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000131
Family Collagen-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  515621.CLJ_B0435
Domain Number - Region: 347-431
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000798
Family Collagen-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B0435
Sequence length 689
Comment (Clostridium botulinum Ba4 657)
Sequence
MVKSKEKNKIFFTLLAITLIFIVNSNKVKANDEINFKRLYGKERYETSASICSGGWDTSE
YAVLASGEGFADALSAAPLAKKYDAPIILTGKNKLNDNAKDQLKKLDTKEVIIVGGPGSI
SEDIVTELKNLGIKVNRIYGEDRYKTSLKIAKEIGVKNGVVVTNGLGFADALAMAPIAAS
KQMPILLTPSDKLTSDTMEFLKKSSYNKSYVLGGTSTVSDYIKNSLKNPTRLSGADRFQT
NIAILNHFKGDLNLDEVYIASGDGYADALSGSVLASKNKSPIILINDNLNKSTKDFVSTN
KSNFKNVTIFGGEAVVKEPTISSLFGAFRSGEIRSDTKEVAAERWDRSYLKDYHIDLPDS
GKLDIEYDINNFTRFDLIVLDIKNNEIIKKSYNYLKNNKSIHDNYNDIRLPKGKYIVRVH
AFNMDGTYTIKAKYTQEGEGFEKENNNDIKTANVIEPNKSIKGSIHSYNDVDYYKFTLNE
KGSLKINLKHNQYGRYGFRVSLLDENNKSITEFISGGEDINSYSNKLRLPKGTYFVRIEC
EKWNDEPLQYELNLVYDIEGENYESEPNDYIQDANYIKCNKEYIGNIQSRDDRDYYKINL
NSDSKITINFKHDEGYEKWIIYLYDKDNNPIRRFKSYGYEINKDFDPIELEAGEYYVSVE
GRDSLDYTINVKREAPDKSDNRNKKVKRR
Download sequence
Identical sequences A0A0E1KSX1
gi|237793699|ref|YP_002861251.1| 515621.CLJ_B0435 WP_003359587.1.28306 WP_003359587.1.34328 WP_003359587.1.49727 WP_003359587.1.95863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]