SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B1730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515621.CLJ_B1730
Domain Number 1 Region: 770-834
Classification Level Classification E-value
Superfamily PKD domain 4.71e-21
Family PKD domain 0.001
Further Details:      
 
Domain Number 2 Region: 971-1085
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000131
Family Collagen-binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 841-951
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000111
Family Collagen-binding domain 0.0007
Further Details:      
 
Weak hits

Sequence:  515621.CLJ_B1730
Domain Number - Region: 291-319
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0968
Family tRNA-intron endonuclease catalytic domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B1730
Sequence length 1095
Comment (Clostridium botulinum Ba4 657)
Sequence
MKKKFIKMICSIAIGCMISTSCIAKVSAAPTNNTKINSNEINISEDSSKSERMPSTDSEP
LGLNAKNTNSSKYSFSDLNKLSNKEILDLTSKIKWNDISDLFQYNDDSYAFYSNRERVQA
LIDGLYEKASTYTSTDDKGIDTLVEILRSGFYLGFYNDSLKYLNNRSFQDKCIPAMLAIE
NNKDFRLGEKGQDTVINALGKLIGNASCNAEVVNKTVPILEQYYREMNKYPRDKLKADAV
YSLMKEINYDISEYAYDHNIRDGKNTPWSSKIDPFINTISKFAGISKVTEDNGWIINNGI
YYTSKFAIYHSNPSIPHSVIDKCLEILPAYSEQYYFAVERIKEDFNSKDSKGNVIDIDKL
LEDGKKHYLPKTYTFDNGKMIIKAGDKVDESKIQRLYWASKEVKSQFHRIIGNDKPLEAG
NADDVLTMVIYNSPEEYKLNRTLYGYSVDNGGIYIEGIGTFFTYERTPEESIYSLEELFR
HEFTHYLQGRYLVPGLFNEGDFYKGNSGRITWFEEGSAEFFAGSTRTSVLPRKSMVGGLS
QNPKERFSADKILHSKYDDGWEFYKYGYAFSDYMYNNNKKLFSDLVSTMKNNDVKGYENL
IEKSSKDFKINKDYQDHMQKLVDNYDSYTIPLVSDDYMKKYDNKALDEIKSDIEKTIGLT
NSQITKENSQYFDTYTLKSTYTLDSNKGEIDNWNCMNNKVNESLEKLNKLGWGGYKTVTA
YFSNPKVNSYNQVEYNVVFHGLLTHNKNFNEAPTIKLDFPKKSNTDEKIKFSSEGSTDDG
KIVSYAWDFGDGETSSEKNPTHAYKTPGTYTVKLTVTDDKGLKAEKTSSITINKVLKGNV
VSEKEDNNDFTNANPVYSKDLVNGSVSSSDNKDTFYFTVTKPSDITITVEKTNKDKSEFN
WLLFNDEDKSNYIAFPNKKLGDQLSNTVKIDKPGKYYLVIYKTLGEKVDYKFSIEGDILA
SPEGDKDKLVISEKENNDSFDKANRVGKNQTVIATLDTNDNRDTYYFDALTAGTVDVIME
NTDNNTNTFNWLAYSSDNTNNYIGYPTKKEGNKIMGSFKVPKPGRYYILAYKNSSNKINY
KLNINGDIDTAPLEN
Download sequence
Identical sequences A0A0E1KY83 A0A2I4P5X8
WP_003362673.1.20373 WP_003362673.1.28306 WP_003362673.1.49727 WP_003362673.1.57916 WP_003362673.1.95482 WP_003362673.1.95863 515621.CLJ_B1730 gi|237794963|ref|YP_002862515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]