SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 517418.Ctha_0273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517418.Ctha_0273
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0000000000000915
Family STM4215-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 517418.Ctha_0273
Sequence length 172
Comment (Chloroherpeton thalassium ATCC 35110)
Sequence
MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWTDADGLVIVRYAGSTY
GQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVITALAGFVPTDCTDALRV
VRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTDIQDLTIAST
Download sequence
Identical sequences B3QTJ8
517418.Ctha_0273 gi|193213992|ref|YP_001995191.1| WP_012498828.1.43748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]