SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_1007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_1007
Domain Number 1 Region: 111-340
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.26e-23
Family Papain-like 0.011
Further Details:      
 
Domain Number 2 Region: 399-582
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000251
Family Pectate lyase-like 0.065
Further Details:      
 
Domain Number 3 Region: 643-696
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000153
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_1007
Sequence length 697
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MSSYPSLRSLLILLICCSLLIFPAAAETVNESLKMPAFFSDIQNRGVDLHATDETPVYTV
MHPSSEQLKEWDAQYNALPLVSVPATGSSSQLQNNTTSVGGYKDLLPYLDYIPAERNQGS
IGNCWVWAGTGVMEIAHAVQNGVKDRFSISYLDANYNGGSGNKWAGTGGDFFNLANFYTT
TGIAVPWSNLNAEYQDGTTWSGTEQRSYEPAFAISTEPHYQIYQIKAQRIETRHIGNEQA
ISNIKAVLDQNRAIGFGFNLPNSTAWGSFIEFFMNSSEETAWNMTPWQNTLYNENEGGGH
EVLCVGYNDTDPTNRYWIMVNSWGVSDGHPRGVFRVSMDMDYSATMQFRDNDDWAALVWQ
TLDVNFAATPSPAPKEISSLPYTCSVPGEYYLAKDLISSDADTGILVTAQNVTIDGKGHL
LRGSGRQGSVGILAYNNGDPVDGLNITNLAISNWEDGCYLYHATNGSVNDTTISDCSYAG
IFLDGETTNLAIADNTLTSNYRGLLSRSTADIRVEHNRITESLNTGLYLLSMNQSLIADN
QIVNGQNVIISGWVNTTSWNTSKTTGQNLAGGPYLGGNYWGNPTQTGFSDLAVDQNRDGF
ADSPNQIAAGTMDQFPLVAYANPGPQPIPPNQLDPTDPDHDRLYEDLNGNGKLDFGDVTT
FFNQMDWIADHEPVQLFDFNGNQQIDFGDVAALFSRL
Download sequence
Identical sequences B8GGV0
521011.Mpal_1007 WP_012617674.1.75456 gi|219851646|ref|YP_002466078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]