SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_1922 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  521011.Mpal_1922
Domain Number - Region: 8-41
Classification Level Classification E-value
Superfamily PKD domain 0.000445
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_1922
Sequence length 60
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MGRPRLNRNLVHVYDVAGRYAISLSAIGSNRARTKTIEQYLNAALVTLPATATHPVPPIG
Download sequence
Identical sequences B8GKT0
gi|219852517|ref|YP_002466949.1| 521011.Mpal_1922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]