SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_2277 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_2277
Domain Number 1 Region: 338-386
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000053
Family Type I dockerin domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_2277
Sequence length 389
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MIRLTVLNGLLAGLLLIATATAAPVIEGCPIFPPDNVWNTRIDTLPTDAYSAAYISTIGS
SRPVHPDFGSGTWEGGPIGIPYVVVNGSQPAVPVSFYYPDESDPGPYPVPSTAPVEGGSE
ATGDRHVLVIDRDNHQLYELYDAHLQSDRSWDCGSGAVFDLNCSALRPVGWTSADAAGLP
ILPGLVRYDEVADGAITHAIRFTAPQTRGAYIWPARHEASSLTGSQYPPLGQRFRLKADY
DISGFSPEVQVILTALKEYGMILADNGSSWYLSGAPDERWNNDLLHELQQVKGSAFEAVD
ESSLMISPDSAAARQRPLLIPGGKMIPSDPDLDGRYEDLDGSGVADFSDVVLFFNQMDWI
GEDEPAGLFDFNGDGRVDFDDVIRVFGML
Download sequence
Identical sequences B8GE65
gi|219852857|ref|YP_002467289.1| 521011.Mpal_2277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]