SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_2459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_2459
Domain Number 1 Region: 26-269
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.03e-41
Family Zn metallo-beta-lactamase 0.057
Further Details:      
 
Domain Number 2 Region: 371-478
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.31e-20
Family Lamin A/C globular tail domain 0.0045
Further Details:      
 
Weak hits

Sequence:  521011.Mpal_2459
Domain Number - Region: 304-358
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000353
Family Type I dockerin domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_2459
Sequence length 479
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MVDPLRYLLPILLLVLLIIPAAAHDPGTLTVSFLDVGQGDAILVQAPNDRAMLVDAGEAW
AGPTVSADLTAEGIARLDYLIASHDDDDHIGGISEVLRHVTIGEFVNNGLPADTETAAHL
WSLLADQGIPSLAATAGDTIPLDPANITVSVLNPPADRGTDQNEDSVVLRLIFGNQSFLL
TGDAGTEAEDRILAVGQPIASTYLKVGHHGSSTSTGTGFVNAVNPTVAIIEAGRFNLFHH
PNQAVVKRLQESGATVYTTAESGTVRVTATRTNSRLETTQGPELPITLPGFSLPPTDPDF
DGTFEDVDGNQQRDFADVVAYFNQMDWIEANEPVDRFDIDRNGQVDFGDVIRLFTIIDEP
IVTPTPTPSPTPTMTQEPDYTLVITGLDLANEWVSVQNTGEAPVDLTGCTLSDAGSTHVY
TFPSFTLAAGSTVTIHTGSGQTTGTDLFWGLGSSVWNNDGDTAALKRPSGTVISTLTRP
Download sequence
Identical sequences B8GEN5
WP_012619055.1.75456 521011.Mpal_2459 gi|219853027|ref|YP_002467459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]