SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_2631 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_2631
Domain Number 1 Region: 11-262
Classification Level Classification E-value
Superfamily NHL repeat 7.85e-49
Family NHL repeat 0.0000239
Further Details:      
 
Domain Number 2 Region: 292-342
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000145
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_2631
Sequence length 343
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MYSTQWGSIGWGYGQFGDPCGVAVDSAGNVYVVDTGTNRVQKFTSTGTFITQWGSAGTRN
RQFFGIGGIAVDSAGNVYVTDEHNSRVQKFDSTGIFITKWGSYGPGDGQFKSPEGIAVDN
AGNVYVVDTVNNQIQKFTSDGTFITKWGTRASGIAVDSDGNVYVTDATSNQVQKFTSDGT
HLLNWGTSGSENGQFSSPEGIAVDNAGNVYVNDVGNQRVQKFTPDSTFVTSWETGASGIT
VDSDSYVYVVDRGNCRIQKFVPAGSTPTISQKKEVPGGDDTPNSTSNSTCDDVNGDGVLD
FNDVVLFFNQMDWIAENEPVSAFDFNKNNQIDFNDVVVLFNTL
Download sequence
Identical sequences B8GF93
521011.Mpal_2631 WP_012619218.1.75456 gi|219853190|ref|YP_002467622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]