SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 522306.CAP2UW1_3408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  522306.CAP2UW1_3408
Domain Number 1 Region: 22-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-74
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 522306.CAP2UW1_3408
Sequence length 387
Comment (Candidatus Accumulibacter phosphatis clade IIA UW 1)
Sequence
MNRLFALLWIALLTGCAAPPLRGTGDLGLVIERASGQVTLVDTSRREPYARIGGFGDLSH
ASVVYSRDGRYAYVFGRDGGLTKVDMLTARIVRRVLQSGNAIGGSISQDGRIVVAQNYTP
GGIKAFDAETLELLSEVPAEYAPGSFSKVVGLADLSGNRFAYALFDGGEIWVSDFSDPRR
PRTQRYPAGLQPYDGLVTPDGRYYLAGLFGEDGVALLDTWQPEQGSRRILANYGRGQEKL
PVFKMPHLRGWSLAQGNAYLPAIGRHEVLVVSGSNWREVGRIKVKGQPVFVIARPDGRQV
WVNYAFPDNGWVEVIDTLTGQVVRTLEPGKAILHMEFTPRGEQVWISARDDDKVLIYDTA
TFARIGEFTAQAPSGIFFTSRAGRTGF
Download sequence
Identical sequences C7RJ57
WP_015767841.1.47741 2000176560 gi|257094956|ref|YP_003168597.1| 522306.CAP2UW1_3408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]