SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 523791.Kkor_1769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523791.Kkor_1769
Domain Number 1 Region: 121-376
Classification Level Classification E-value
Superfamily Subtilisin-like 2.62e-78
Family Subtilases 0.00000143
Further Details:      
 
Domain Number 2 Region: 35-118
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000453
Family Subtilase propeptides/inhibitors 0.0031
Further Details:      
 
Domain Number 3 Region: 407-504
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000222
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 523791.Kkor_1769
Sequence length 617
Comment (Kangiella koreensis DSM 16069)
Sequence
MKLNQIVAGILLATGVTGAYAGEFKTASVPSKAIKGQYIVVLKDDAVAQNMGQFSSNASE
QAIQMMTENLSRKYQAQVQRTYTKALKGGTFTLSEKAAQKLAQDPNVLLVEEDQIVSLNA
TQNNATWGIDRVDQRNLPLSGTYTYNTTASNVNAYIIDTGILNSHSEFGGRSVSGIDTVD
NDNDATDCNGHGTHVAGTVGGSTYGIAKSVNLIGVRVLNCSGSGTLSGVIDGIDWVASNH
TKPAVANMSLGGGASSSIDTAVANLVSSGVTVVVAAGNDNSSACNYSPAREPSAITVGST
TSSDSRSSFSNYGSCLDIYAPGSSITSAWSNGGTNTISGTSMASPHVAGVAALYLADNPS
ATPSQVDTAITDSATPGVVSDAKSGSPNLLLYSLFDGTNPDPDPDPEPGNELENGVSVTF
SGAQYSETDFTFEVPSAASNVSFDMSGGSGDADLYVKFGSAPTTSSYDCRPYRNGNNESC
DFSAQTGTYYVMVRGYTSYSNVSLVATHDGDGSEPPAEGGSETYPNLSGASGSWTHYYVD
IPAGMSSLDVQMSGGSGDADLYVRRGAQPTTSSYDCRPYRWGNDETCSFSNPAQDRWYIS
IRGYSSYSGVTLQIDWQ
Download sequence
Identical sequences C7RD39
WP_015780787.1.96353 523791.Kkor_1769 gi|256822986|ref|YP_003146949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]