SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 523791.Kkor_2257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523791.Kkor_2257
Domain Number 1 Region: 121-380
Classification Level Classification E-value
Superfamily Subtilisin-like 1.7e-80
Family Subtilases 0.00000113
Further Details:      
 
Domain Number 2 Region: 35-118
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000363
Family Subtilase propeptides/inhibitors 0.004
Further Details:      
 
Domain Number 3 Region: 427-505
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000314
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523791.Kkor_2257
Sequence length 618
Comment (Kangiella koreensis DSM 16069)
Sequence
MKLNQVVAGVLLATGVTGAYAGEFQAAAQPEKAIKGQYIVVLKDDAVAANMGLFSSNASE
QAIAMVSDNLSRKYQAQVQRTFTKAVKGGVFNMSEKAAQKLAQDPNVLIVEEDQIVSINA
TQNNATWGLDRIDQRNLPLSGSYTYNTTASNVNAYIIDTGILGSHSEFSGRFMGGYDFVD
NDSNPNDCNGHGTHVAGTVGGSTYGVAKGVKLYGLKVLGCNGSGTNSGVIAGIDWVANNH
VKPAVANMSLGGGASSTTDNAVANLVASGVTVAVAAGNDNSNACNYSPAREPSAITVGST
ASNDSRSSFSNYGSCLDIYAPGSNITSAWSNGGTNTISGTSMASPHVAGVAALYLANNPS
ATPSQVEAAIEGAASTGKVSDAKSGSPNLLLYSLFDGSTPDPDPEPQPGNELENGVSVSF
SGASGSETDFTFQVPSDASNVSFDMSGGSGDADLYVKFGSAPTTSSYDCRPYRNGNSESC
DFSAQTGTYYVMVRGYTSYSNVNLVATHDGGGSTEPPPEGGSARLDNLSGASGSFTHYYV
DLPAGMSSLDVQMSGGSGDADLYVRKGSQPTTSSYDCRPYRNGNNESCSFSNPAQDRWYI
SIRGYTSYSGVSLQVDWQ
Download sequence
Identical sequences C7R8A1
523791.Kkor_2257 gi|256823471|ref|YP_003147434.1| WP_015781271.1.96353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]