SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_0093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_0093
Domain Number 1 Region: 20-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-105
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_0093
Sequence length 344
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MATTQDEISATNSQDRHTELGLTAEDLKKMYRLMVLARTLDERMWILNRQGKVHFVISGQ
GQEGAQIGTAYALRPGVDFFVPYYRDLTVCLYAGVTPREIMLSLFARADDPASGGRQMPG
HYSYKPLKIVTGSSPIATQIPHAVGIALASKIKNEDVVTAVWFGEAASSKGDFHEGLNFA
GVIKAPVIFICENNHYAISVPQNKQMAVPNVADKACAYGFPGVVTDGNDVLDVYKAMKAA
VERARAGEGPTLIECKTYRIVPHSSDDDESRYRTKVEVEEWKRKGPIERLRTYMQAQGIW
SEEFENQVKSEALSIVDDATRFAEQASPPSPSSLLRHVFAEEAK
Download sequence
Identical sequences D1CDK9
gi|269925214|ref|YP_003321837.1| WP_012874050.1.85100 525904.Tter_0093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]