SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_0186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_0186
Domain Number 1 Region: 377-573
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.85e-67
Family Pyruvate oxidase and decarboxylase PP module 0.00000971
Further Details:      
 
Domain Number 2 Region: 16-195
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.49e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000348
Further Details:      
 
Domain Number 3 Region: 173-367
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.91e-57
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_0186
Sequence length 576
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MAITIDKPKIEETKKKETKKLSGARIMCEALVNEGVEIIWGYPGGAIMPFYDVLPEYPSI
HHVLVRHEQGAAHAADGYARVTGKVGVCVATSGPGATNLVTGLATAYMDSVPIVAITGQV
ARPFIGHDSFQETDIVGITLPITKHNFLVTSADSLGEVIHEAFRIAREGRPGPVLIDVPK
DVQFEEGEYTPPEKTWEERNSDNGSAYTDEYIRAARIIDSAQRPLIMAGHGIIISKAYDE
LRAFAEKTGIPVITTLLGLSAFPENHPLALGMPGMHGPAHVNLAIDEADLIVGVGLRFDD
RVTGNLKEFAPNARFIHIDIDPAEIGKNIKPEVGIVADAKEALAKLTELVSKKEHSGWLE
EIKRREKPERSVMKTTKISPYDVLKAIKKATNGEARIVTDVGQHQMWAARFYGWEKPNSH
ISSGGLGTMGYALPAAMGVKAGCPEDPVWVVAGDGGIQMNIQELGTIVQENLDIKVAIIN
NGYLGMVRQWQEFFHNRNYSETRISSPDYSLIATAYGAKGRRVTRKEDVEAAVEWAMSQP
GCVILDFEIEQEANVYPMVPSGGSVKTMILDPEANE
Download sequence
Identical sequences D1CDV2
gi|269925307|ref|YP_003321930.1| WP_012874143.1.85100 525904.Tter_0186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]