SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_0385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_0385
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000103
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_0385
Sequence length 269
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVVSDGAGSAARGDEGSE
FACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERANSCEAQISDYASTLLAA
VVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTTFFLTDNNSHENLLILSL
DDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQFDGYLQELSEQLKNFLGS
PRVNEYTEDDKTLLLASRVIGQQLSEVPD
Download sequence
Identical sequences D1CEF1
WP_012874342.1.85100 gi|269925506|ref|YP_003322129.1| 525904.Tter_0385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]