SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_0636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  525904.Tter_0636
Domain Number - Region: 212-365
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0144
Family Pyruvate oxidase and decarboxylase, middle domain 0.032
Further Details:      
 
Domain Number - Region: 365-436
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0147
Family Pyruvate oxidase and decarboxylase, middle domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_0636
Sequence length 450
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MQGQNNGRSSLPFYKTIELRGHIIDSHILSQVMDLVMDYNAEFYIEQFEVGKHKYDPSYA
RLILYAPTPETLDELMEAVTKLGAQLLESEEVDARTEPAPKDGVLPEDFYSTTNMPTEVR
IDGKWFPVENIEMDVAIAIRLNEEGKPIGAYTVPMSDVRKGTPIVVGHQGIKVSPIERPR
SPALLGSPSRASQGHVFSFMSSAVSTERPKAAAIAEIAQRMREIRDSGGTTLVVGGPAIV
HTGAGPQLAALIRHGFVHLLFAGNALAAHDIESAFFNTSLGVSLDANSEGATYEHGHEHH
IRAINKIRYYGGIRQAVEAGVLKQGIMYECIVNNVPYVLAGSIRDDGPIPDVITDVIEAQ
RAMRRHIQAGVDLALLIGTTLHSIAVGNLLPANVLTVCVDINPSVVTKLLDRGSLQTAGL
VIDAGGFLRELCYQLGLREKSSIDSPTKVQ
Download sequence
Identical sequences D1CF47
WP_012874588.1.85100 gi|269925752|ref|YP_003322375.1| 525904.Tter_0636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]