SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_1682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_1682
Domain Number 1 Region: 50-302
Classification Level Classification E-value
Superfamily PP2C-like 1.11e-61
Family PP2C-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_1682
Sequence length 313
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MLSDIWKKIRNTEQTGDSGTEPERLSDEITQPLPVMEVNKANSGDVILGIRAAARTDSGR
VRRTNEDDVLLALPESNESVLPTIGIVAIADGMGGHDKGEVASRTAIEATINHLQNNPFF
TEGHFLRQNLSDDDVVNVVREAVQTANRAVYRTKVEQSTDMGTTLVLALILRGKSYIANV
GDSRAYIVRDRAIRRITEDHSLVERMIAAGQITEIEARRHPQRNLIFRSLGTEPVVEIDM
FVEPLRSGDRLLLCSDGLNSMVSDDVIADIVSHESDVDRACRLLIRAANDAGGADNISVA
LVEMVALEDQTSM
Download sequence
Identical sequences D1CCS3
gi|269926787|ref|YP_003323410.1| 525904.Tter_1682 WP_012875622.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]