SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_2777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_2777
Domain Number 1 Region: 1013-1212
Classification Level Classification E-value
Superfamily Kelch motif 1.9e-55
Family Kelch motif 0.0000706
Further Details:      
 
Domain Number 2 Region: 899-1040
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.29e-23
Family Galactose oxidase, central domain 0.028
Further Details:      
 
Domain Number 3 Region: 545-762,789-813
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000000000235
Family Soluble quinoprotein glucose dehydrogenase 0.0068
Further Details:      
 
Domain Number 4 Region: 1631-1761
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000074
Family YxiM N-terminal domain-like 0.034
Further Details:      
 
Weak hits

Sequence:  525904.Tter_2777
Domain Number - Region: 396-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000111
Family Beta-D-xylosidase C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_2777
Sequence length 1762
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MKVLRSLIVALIILTSGLAPYVMSSHSYAAGNKPTETLGVRASSPALFFGHRGDRRRSAP
LEEGSVLSGKVYVFAQARNVNRAYFFLDVPSRSSDLVPWGVRPLRVDARPPYDLVGDNGN
KALPLDTSKLANGTHTITAAFEGKDGSVQTMTKSFVVYNGPRALLITPQRISLELPKGGK
TSIPLNVLSSDNRPVRYSLSKSVDWMRLEPAFPDPQRLRGKAPQERVISLNAGKLAPGNY
RATLRATAPGYRAGEVSIELTVTKGNASSRQIKALQASTQAVTSSSSCYPLDCSQILVEL
PYNLDFSGDEGKILDKNGVGTGFTYVDQPSKGTGYIPQNLTVDTSGTGTLNILTTKGINS
GTANSQDNALGVGIDAPSQISVLKTTVINPPLGSGNYEQAGLWFGNNEDNYLKLGVLSTP
KGLRIQYLIEVGGTTQSSKTTSAMSLANAKITFTLRANPGDQTVKAYYQINNNSQVLFGT
FTAPAEFFSFDAAGIDPRIGTRSFGGIYATHRKGPSPLTYKFDDFSVTADGIGSPPDSNL
TFDRVSFPVPFPTSMVWGPDNRLYVTELLGKIHAITLDDDKHVVSDQVITTLGSRLTLGI
TVDPASTPDNVILWVSHSSPDLNNGVLNSSMVTKLWGPGFTNRQDVITGLPRAIANHAVN
SIHFGPDGKLYIAQGGNTGAGAPNTANTEFGTRAEQPLSAAFLVADVKAPGFDGTCATPE
NTYGPSPCDVFLYSSGLRNMYDFTFHSNGSIYGPDNGLGVVGTYPPSPTPPCEGFGNPQT
NNPGEQPDNLQRLLPGKYYGHPNPYRNECVFKDGSYQGVAPLPNYAQPFYVLGKNKSADG
IIEYRGEAFNGALKGELLITNYSVGDDITRVRLSSDGLSVVEKKQLAAGFDDPLPITQGP
DGTIYVGEFGGSKVTALIPSNPGSWTTRQPLPVSLLDAGGTVINGKLYVVGGKTSSGGHQ
TKLYIYDPITDSWTTGQDMPGPGVENPGVAAYNGKMYVFGGSTDPFSGAVNFSYMYNPNT
NTWSTIASMPTARGGAGAQQINGKIYVVGGMDSNGASLATLEIYDPATNTWSTGAPMSTR
RDNPGTATLGGKLYVFGGRTRNADGSTPANILASAEVYDPATNTWAAIAPMPTARRTMVT
GILKGRIQVMGGEITSTGGAFPQNEEYDPATNTWLTLTPMLTPRHGAVAGTINNTIYVAG
GGPQGGAAFTNVNEAFAFNTINTNVDTSINAGPTGIVANSSATFSFSSNDPSATFECRLD
GAPFTACSSPVTLSGLADGSHTFEVRAISPTNGTDQTPAGRTWVVDTTRPQVASTSPAHG
TTDVPVTTNVQAVFSEPMDPVTINANSFYLVKEGTTTHLSATVSYDQANARATLVPASNL
KEGAIYTATIMATVKDMAGNSLAANYSWSFTVTSVDNTPPETTITAGPTGLTNQTSATFQ
FTSSEDNSSFLCSLDGSPFSPCSSPVAYSGLQDGSHTFQVKAVDQAGNQDPSPASRAWII
DATPPTITGTTPVDGPNGVAVHTNVVISFSEALAPGSVQDTSVYLTKQGETNKVQGTLSY
DNDSFKVTLDPTANLEPNTTYVVTVKGGAGGITDAIGNPLATDRTWSFTTASATAFVPIR
VDSGNTSSYTDTGGNVWSADTGYTGGSVTKGTTSDIAGTNDDRLYQKGRSGAPFSYRFQV
PNGTYTVRLKFAETYWTRAGQRVFNVNIEGSRVLSNFDILQTVAPKTALDRTFKVEVSDG
RLDVDLTSVVNYPLVSALEITE
Download sequence
Identical sequences D1CIU2
525904.Tter_2777 gi|269839792|ref|YP_003324485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]