SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_1360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_1360
Domain Number 1 Region: 72-132
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000575
Family Occludin/ELL domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_1360
Sequence length 209
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MKEFSLTYLVSILSVFISSATAVFLSIIAYKQNKKLNLQKEEHDRNLTRQKNEFDKEITR
LSGSIERMNFVHKTQFDTEFELYKKIWLEISNITKSFHNIQDHLTELNSTDNDCSEANKA
LKNEYNLLKSYSSVFSEIIDKNRPFYFQELYSLLIIFSNQSKILAEYLSNDDYQKIDLDS
YLYEMVKLLNFSVSIEEIIRNRIENLKIV
Download sequence
Identical sequences D1AHJ1
gi|269119979|ref|YP_003308156.1| WP_012860821.1.35130 526218.Sterm_1360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]