SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI76387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI76387
Domain Number 1 Region: 460-525
Classification Level Classification E-value
Superfamily HMG-box 0.000000746
Family HMG-box 0.0038
Further Details:      
 
Domain Number 2 Region: 55-114
Classification Level Classification E-value
Superfamily HMG-box 0.0000733
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI76387
Sequence length 793
Comment (Phanerochaete chrysosporium)
Sequence
MSRQHCSSTPDYNQPHEPAPPAYTPPPHAISTPNADPDNHAPTPSSTSATTDSNGGSKVP
VNSFMYFRAHAVDMLCKKGLHHALFAIARDLWNEKTAEEKQWWKNRLDEANARCLLETGR
DLVGQVPSYRIADLDATKIAAPGRVEELYSWPERSFLQSGDHAPSNARHATRRRRRPRAL
RGVSQNDSDSSRSGSPSSVSTXDFAHAAAPAVYATYPITLPCQASFTAVAPPIFPTDHGQ
SYVEPSMQIYSSSEILASLHAQGEVISVDELERVLLDDASMPYLYNSPVPQQTVPPYENF
PYAVGYQSDYIDPAQGLVDPCQDLQLLEALEVQGCIVPEATSHHDVQDSCYDQVSSGAFD
RVYSPLVSAIPRQYPSRQPSSSYRSFDTDMPDSDGGLVALYIDAPYDDVQPISTTTKYLY
PRFTLYELLASPPSDPPNFPADAEPSPEPIASLDAPSATAPKKKRRKTLNAFIFFSQHVR
QRLPKEHQDKFRLRFDFTRFASCLWNRLSEETVEEWYARRDTAEDRCREETGHDLVGNGT
DYLVNVTWRELVPEDVEKAAIYAFDHPDPAEVAKKQERKERKRKRQEERSAAAQRARECD
DQHPDCVPSHRRKKPYLPSAPLSQYTIEGCVGLPQTPLPCTSDGRVYNVPTLRTADTRIV
YSDADIQHPYANGAYPSEFAYEDTIMLPHVNPQSQTAPLSPVPESEPHAIPQAEDAYYCP
TRDDHAFGSPNFDYEFTFALESLATHLGTGVCTDDSYDGRWFTVDALCGQGSMLDGSQTY
DIYRATSVDGGLN
Download sequence
Identical sequences 5306.JGI76387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]