SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI98596 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI98596
Domain Number 1 Region: 131-641
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.22e-156
Family Calponin-homology domain, CH-domain 0.00000000000752
Further Details:      
 
Domain Number 2 Region: 7-88,154-174
Classification Level Classification E-value
Superfamily EF-hand 0.000000141
Family Polcalcin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI98596
Sequence length 645
Comment (Phanerochaete chrysosporium)
Sequence
MEALRLRKKFPEVSQDELFDLINRFNSISTDTPGRVDKSSVLHALQSSGESYDRARETLK
HVSVDASGKVELEDWVEVRLRSRAPLERGPYKCRVTAQCQAEAASTAXTALPSKAGKVTV
QGSNANVAHTINEDERREFTHHINAVLEGDPDVGHRVPIPTDTMQIFDECRDGLILSKLI
NDSVPETIDVRVLNKPTPKKPLNAFQITENNNIVITSAKAIGCSVVNIGSTDIAEGREHL
ILGLIWQIIRRGLLSQIDIKIHPELYRLCEEGETIDDLLRLTPDQILLRWFNYHLKAAGW
KRRVNNFSRDVSDGENYTVLLHQLKPDQCSLDPLQTRDLKTRAEQVLQNADRIGCRKYLT
PTALVSGNPRLNLAFVANLFNNHPGLEPLDEQEAKDYGVVEDFDAEGEREARVFTLWLNS
LGVEPAVFNLFQNLRDGLVILQAFDKIMPGSVVWRRVNKPKEGAQPSTLSRFKQVENCNY
VIDLGKQNGMHLVGVQGSDIVDAQRTLVLGLVWQLMRCVVFVLLARDAAKGRPISDQDIL
KWANTTVQKGKPGARTIRSFKDPYLTTGIFLLDLLEALRPGIVDPTLIINVSESGDYEDR
RQNAKLAISIARKANALIFLVPEDIVDVRSRLIMTFVGSLMALDK
Download sequence
Identical sequences 5306.JGI98596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]