SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 537021.CLIBASIA_00830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  537021.CLIBASIA_00830
Domain Number 1 Region: 37-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-35
Family Glutathione peroxidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 537021.CLIBASIA_00830
Sequence length 201
Comment (Candidatus Liberibacter asiaticus psy62)
Sequence
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI
VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR
IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK
DDSDSAIEKINRLITYGNVVK
Download sequence
Identical sequences C6XHL1
gi|254780281|ref|YP_003064694.1| WP_012778500.1.15810 WP_012778500.1.15976 WP_012778500.1.16756 WP_012778500.1.18731 WP_012778500.1.3509 WP_012778500.1.50033 WP_012778500.1.77054 WP_012778500.1.78654 WP_012778500.1.79050 WP_012778500.1.94010 537021.CLIBASIA_00830 gi|470204643|ref|YP_007598741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]