SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 537021.CLIBASIA_01810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  537021.CLIBASIA_01810
Domain Number 1 Region: 46-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-35
Family DsbA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 537021.CLIBASIA_01810
Sequence length 232
Comment (Candidatus Liberibacter asiaticus psy62)
Sequence
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI
GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML
ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL
DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
Download sequence
Identical sequences C6XEZ8
gi|254780477|ref|YP_003064890.1| 537021.CLIBASIA_01810 WP_012778696.1.15810 WP_012778696.1.15976 WP_012778696.1.16756 WP_012778696.1.18731 WP_012778696.1.3509 WP_012778696.1.50033 WP_012778696.1.77054 WP_012778696.1.78654 WP_012778696.1.79050 WP_012778696.1.94010 gi|470204836|ref|YP_007598934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]