SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 537457.APP7_0635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  537457.APP7_0635
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily CAC2185-like 5.36e-91
Family CAC2185-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 537457.APP7_0635
Sequence length 206
Comment (Actinobacillus pleuropneumoniae serovar 7 AP76)
Sequence
MLKLAKKALNKFLRKTINRRNRQQLQNHTMSVLSINCNGAFILHDLNEQFRSPFVNLYLS
PTDFLKYLKNMPHYMQAELTFIASEKNYPVGKLDDLTIHFMHYNSEQEAASKWAERSKRI
NLDNLFVMMTDRDGCTYQDLQEFDRLPFANKVVFTHKPYPELKSAFYIEGFENQTQVGDL
FEFSGWDGKKYYDQLDYVNWFNGKGF
Download sequence
Identical sequences A0A0S4Q8J6 A3MZV6 B0BUE8 B3H118 E0EJC0 E0FLQ2
WP_005603976.1.1361 WP_005603976.1.38484 WP_005603976.1.44215 WP_005603976.1.45850 WP_005603976.1.46870 WP_005603976.1.47094 WP_005603976.1.59265 WP_005603976.1.61038 WP_005603976.1.67471 WP_005603976.1.74087 WP_005603976.1.77337 WP_005603976.1.87845 WP_005603976.1.91190 WP_005603976.1.97452 gi|165976004|ref|YP_001651597.1| 416269.APL_0590 434271.APJL_0583 537457.APP7_0635 gi|190149904|ref|YP_001968429.1| gi|126208072|ref|YP_001053297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]