SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 546414.Deide_09170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  546414.Deide_09170
Domain Number 1 Region: 136-403
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-71
Family Subtilases 0.0000014
Further Details:      
 
Domain Number 2 Region: 54-132
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000907
Family Subtilase propeptides/inhibitors 0.0056
Further Details:      
 
Domain Number 3 Region: 445-511
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000068
Family Collagen-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 546414.Deide_09170
Sequence length 514
Comment (Deinococcus deserti VCD115)
Sequence
MKVRLALCTFGLTVMLAACGQPQSSTPDLATAPGSQRSQTDLAPLLGTSSPEAITGQYIV
VFSDGALGSDLTAQDASGLINSLKLDPQGVSIQHIYTQALSGFAAKLSAQNLAVLRADKR
VKYIEQDGRMHATATQSGATWGLDRIDQRSLPLDSNYVYNSTASGVKAYIIDTGINTGHT
NFGGRAVWGTNTTGDGNNTDCQGHGTHVAGTVGSATWGVAKGVQLIAVKVLDCNGSGTNS
GVIAGVNWAVSNKGSSTAVANMSLGGGFSQALNDAVNSAASKNLVMVVAAGNENQNACNV
SPASAASAITVGSTTRTDARSSFSNYGSCLDIFAPGSDITSTWIGSTTATNTISGTSMAS
PHAAGAAALLIAAGNTTNSSVTSALINNATTGKVTSAGTGSPNRLLYTGSGTGTTPGTTT
TYTGSVSSGTSSFKPSTSGFSYGGGTLKGNLSGPSGTDFDLYLQKWNGSAWADVAASEGG
TSTEAISYAANSGTYRWEVYAYSGSGSYTLTETK
Download sequence
Identical sequences C1D1S0
546414.Deide_09170 gi|226355808|ref|YP_002785548.1| WP_012692917.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]