SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 546414.Deide_21240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  546414.Deide_21240
Domain Number 1 Region: 3-188,272-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.23e-38
Family Bacterial dinuclear zinc exopeptidases 0.015
Further Details:      
 
Domain Number 2 Region: 165-273
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000000155
Family Bacterial exopeptidase dimerisation domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 546414.Deide_21240
Sequence length 361
Comment (Deinococcus deserti VCD115)
Sequence
MPLSYLVRIAQTPAPTFQEAQRAELVASLWEELGYQTTRDEVGNVLTRISTPAIHNQPAL
LLAAHLDTVFDAGTDVRVREEAGRLVGPGVGDNSASLAVITAFLRDFRGMAHTLRRPLWV
AANVAEEGLGDLRGAKHLLAQHRKALGAFVAVDGYLGVAVTRGVAVRRYRASFLGPGGHS
WGDQSPSALHALGRAIAALYALPLPLSPRTTLNVGVASGGTSVNSIASGAELLLDLRSLD
PELLADLDTRAVAALHTAAREVGVIVRVERVGDRPGGDLHSEALLPLARQAARELRVDVR
TTSSSTDANAAAPYGIPALALGVYRGGNAHRHDEWVQASSLGPGLRLLQRLVELYQRSPA
A
Download sequence
Identical sequences C1CYW8
546414.Deide_21240 gi|226357162|ref|YP_002786902.1| WP_012694269.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]