SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0000819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0000819
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-36
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0000819
Sequence length 103
Comment (Candida albicans)
Sequence
MVHVVTEVNEFQTLLKENNLVIVDFFATWCGPCKMIAPLLEKFQNEYSNIKFLKIDVDQL
GSLAQEYNVSSMPTLILFKNGEEVNRVIGANPAAIKQALASLA
Download sequence
Identical sequences A0A1D8PU69 C4YN54
5476.CAL0000819 XP_719372.1.88832 CAWT_02294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]