SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0002595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0002595
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-31
Family YKR049C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0002595
Sequence length 172
Comment (Candida albicans)
Sequence
MSLFRSLQNSPSTISIFHNSSIPLSNKLYDILEKAYDTQPEKPKHEFQIDLMKNKMPTYD
QYKLIVDKYLKGSTSKTILHNCFPFLHDSKTELYNSKGNVVTVKGVEWANKTFSPAEYQM
IYDTFNKLQESSDQSINTIASNVFQAPLVVDWDNDVIAGDEETLKAILSKYN
Download sequence
Identical sequences C4YTY9 G1UAZ9 Q9UVI8
CA4437 CAWT_05637 XP_716980.1.88832 5476.CAL0002595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]