SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0003032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5476.CAL0003032
Domain Number - Region: 58-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0125
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0003032
Sequence length 153
Comment (Candida albicans)
Sequence
MSTRMFITSKNKYNKKIENAIKKINKLTANPETSFKFDAERFKEIELFVYGQRPITYKPA
WGLKLFWKDNLPTLRYHNPDIQFTVNNITVESESELSKLPLKLKVHGTDQSNSFEINCTD
KPPSKILSELIEITKARKLTEEELPKLPLRPVK
Download sequence
Identical sequences C4YTR7 G1UAT6 Q5AH35
5476.CAL0003032 CAWT_05562 XP_721341.1.88832 CA4968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]